PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn060061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 206aa    MW: 22604.8 Da    PI: 5.1964
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn060061genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.44.2e-42441441101
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i++lq+q+++l+a+la++++
  Achn060061  44 PCAACKILRRRCAEKCVLAPYFPPTDPIKFTTAHRVFGASNIIKFLQELPESRRADAVSSMVYEANARLRDPVYGSAGSIFQLQNQVNELQAQLAKAQA 142
                 7************************************************************************************************99 PP

      DUF260 100 el 101
                 +l
  Achn060061 143 QL 144
                 85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.74743144IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4144141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MYKCDQLIYK SELLGDISDI SLSPQSLSPN SSTSPPPSQV VLSPCAACKI LRRRCAEKCV  60
LAPYFPPTDP IKFTTAHRVF GASNIIKFLQ ELPESRRADA VSSMVYEANA RLRDPVYGSA  120
GSIFQLQNQV NELQAQLAKA QAQLVTMQSQ QANLVAFICM EMAQSPPPPP PSPLSINLDN  180
FNMNSPYNLF PDETNPGSLW DPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010244970.13e-84PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0L9UNR14e-84A0A0L9UNR1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SGG94e-84A0A0S3SGG9_PHAAN; Uncharacterized protein
TrEMBLG7IKN35e-84G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA13G40370.26e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-59LOB domain-containing protein 1